SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000253401 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000253401
Domain Number 1 Region: 95-308
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-60
Family DBL homology domain (DH-domain) 0.00000000253
Further Details:      
 
Domain Number 2 Region: 293-447
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-48
Family Pleckstrin-homology domain (PH domain) 0.0000000535
Further Details:      
 
Domain Number 3 Region: 9-111
Classification Level Classification E-value
Superfamily SH3-domain 6.69e-21
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000253401   Gene: ENSG00000131089   Transcript: ENST00000253401
Sequence length 516
Comment pep:known chromosome:GRCh38:X:63634967:63755113:-1 gene:ENSG00000131089 transcript:ENST00000253401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPAS
FVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIK
HLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEI
GPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLL
TPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQW
QASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDIL
YYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAF
REERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQY
LVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK
Download sequence
Identical sequences A0A2I3HJH7 A0A2J8UB53 A0A2K5JQM4 A0A2K5NI18 A0A2K5U923 A0A2K5XVY9 A0A2K6AMV7 A0A2K6Q4G2 H9EPM3 O43307
ENSGGOP00000003105 ENSP00000253401 ENSP00000469587 ENSP00000253401 ENSNLEP00000000478 NP_056000.1.87134 NP_056000.1.92137 XP_003281186.1.23891 XP_005593824.1.63531 XP_007990089.1.81039 XP_010370593.1.97406 XP_011731203.1.29376 XP_011802800.1.43180 XP_011820425.1.47321 XP_011916341.1.92194 XP_011916344.1.92194 XP_014983056.1.72884 XP_016884855.1.92137 ENSGGOP00000003105 ENSP00000253401 gi|7662108|ref|NP_056000.1| 9606.ENSP00000253401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]