SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000254941 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000254941
Domain Number 1 Region: 1-94
Classification Level Classification E-value
Superfamily Pre-PUA domain 2.03e-43
Family Nip7p homolog, N-terminal domain 0.00000175
Further Details:      
 
Domain Number 2 Region: 92-123
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000845
Family PUA domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000254941   Gene: ENSG00000132603   Transcript: ENST00000254941
Sequence length 133
Comment pep:known chromosome:GRCh38:16:69339797:69343104:1 gene:ENSG00000132603 transcript:ENST00000254941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISG
DKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKGFGVAAKSTQDCRKVDPMAIVVFHQA
DIGEYVRHEETLT
Download sequence
Identical sequences A0A2I2YWI1 A0A2I3S5Q3 A0A2J8VVP3 A0A2K5F165 A0A2K5Q6F2 A0A2K6TQP6
ENSP00000254941 HR714 NP_001186363.1.87134 NP_001186363.1.92137 XP_010348992.1.74449 gi|313661502|ref|NP_001186363.1| ENSP00000254941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]