SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000255084 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000255084
Domain Number 1 Region: 7-351
Classification Level Classification E-value
Superfamily ALDH-like 8.25e-106
Family ALDH-like 0.00000000491
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000255084   Gene: ENSG00000132746   Transcript: ENST00000349015
Sequence length 385
Comment pep:known chromosome:GRCh38:11:67662163:67674631:-1 gene:ENSG00000132746 transcript:ENST00000349015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSE
ISQGTEKVLAEVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAAT
KHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLL
PALQSTITRFYGDDPQSSPNLGHIINQKQFQRLRALLGCSRVAIGGQSNESDRYIAPTVL
VDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKPLALYAFSNSSQVVNQMLERT
SSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLAPSGLEKLKEI
HYPPYTDWNQQLLRWGMGSQSCTLL
Download sequence
Identical sequences P48448
ENSP00000255084 ENSP00000431595 ENSP00000255084 ENSP00000255084 ENSP00000431595 9606.ENSP00000255084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]