SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000255198 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000255198
Domain Number 1 Region: 46-101
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000075
Family BED zinc finger 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000255198   Gene: ENSG00000132846   Transcript: ENST00000255198
Sequence length 234
Comment pep:known chromosome:GRCh38:5:77072072:77087323:-1 gene:ENSG00000132846 transcript:ENST00000255198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGEPACTMDQARGLDDAAARGGQCPGLGPAPTPTPPGRLGAPYSEAWGYFHLAPGRPG
HPSGHWATCRLCGEQVGRGPGFHAGTSALWRHLRSAHRRELESSGAGSSPPAAPCPPPPG
PAAAPEGDWARLLEQMGALAVRGSRRERELERRELAVEQGERALERRRRALQEEERAAAQ
ARRELQAEREALQARLRDVSRREGALGWAPAAPPPLKDDPEGDRDGCVITKVLL
Download sequence
Identical sequences Q96IU2
ENSP00000255198 gi|14150185|ref|NP_115743.1| NP_115743.1.87134 NP_115743.1.92137 ENSP00000255198 9606.ENSP00000255198 ENSP00000255198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]