SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000257979 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000257979
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily Aquaporin-like 7.72e-70
Family Aquaporin-like 0.00000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000257979   Gene: ENSG00000135517   Transcript: ENST00000257979
Sequence length 263
Comment pep:known chromosome:GRCh38:12:56449502:56454642:-1 gene:ENSG00000135517 transcript:ENST00000257979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWELRSASFWRAIFAEFFATLFYVFFGLGSSLRWAPGPLHVLQVAMAFGLALATLVQSVG
HISGAHVNPAVTFAFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNT
LHPAVSVGQATTVEIFLTLQFVLCIFATYDERRNGQLGSVALAVGFSLALGHLFGMYYTG
AGMNPARSFAPAILTGNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSISERLSVLKGA
KPDVSNGQPEVTGEPVELNTQAL
Download sequence
Identical sequences G3RKA2 H2Q690 P30301
ENSGGOP00000016164 ENSPTRP00000008676 ENSGGOP00000016164 ENSP00000257979 ENSPTRP00000008676 ENSP00000257979 NP_036196.1.87134 NP_036196.1.92137 XP_001168857.1.37143 XP_003824960.1.60992 XP_004053430.1.27298 ENSP00000257979 gi|6912506|ref|NP_036196.1| 9598.ENSPTRP00000008676 9606.ENSP00000257979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]