SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000260229 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260229
Domain Number 1 Region: 273-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.09e-61
Family Hemopexin-like domain 0.00000114
Further Details:      
 
Domain Number 2 Region: 101-261
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.39e-54
Family Matrix metalloproteases, catalytic domain 0.00000558
Further Details:      
 
Domain Number 3 Region: 17-96
Classification Level Classification E-value
Superfamily PGBD-like 7.53e-21
Family MMP N-terminal domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000260229   Gene: ENSG00000137675   Transcript: ENST00000260229
Sequence length 513
Comment pep:known chromosome:GRCh38:11:102691487:102705806:-1 gene:ENSG00000137675 transcript:ENST00000260229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLLLLFLFFITFSSAFPLVRMTENEENMQLAQAYLNQFYSLEIEGNHLVQSKNRSLID
DKIREMQAFFGLTVTGKLDSNTLEIMKTPRCGVPDVGQYGYTLPGWRKYNLTYRIINYTP
DMARAAVDEAIQEGLEVWSKVTPLKFTKISKGIADIMIAFRTRVHGRCPRYFDGPLGVLG
HAFPPGPGLGGDTHFDEDENWTKDGAGFNLFLVAAHEFGHALGLSHSNDQTALMFPNYVS
LDPRKYPLSQDDINGIQSIYGGLPKEPAKPKEPTIPHACDPDLTFDAITTFRREVMFFKG
RHLWRIYYDITDVEFELIASFWPSLPADLQAAYENPRDKILVFKDENFWMIRGYAVLPDY
PKSIHTLGFPGRVKKIDAAVCDKTTRKTYFFVGIWCWRFDEMTQTMDKGFPQRVVKHFPG
ISIRVDAAFQYKGFFFFSRGSKQFEYDIKTKNITRIMRTNTWFQCKEPKNSSFGFDINKE
KAHSGGIKILYHKSLSLFIFGIVHLLKNTSIYQ
Download sequence
Identical sequences Q9H306
gi|73808268|ref|NP_071405.2| ENSP00000260229 NP_071405.2.87134 NP_071405.2.92137 ENSP00000260229 9606.ENSP00000260229 ENSP00000260229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]