SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000260302 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000260302
Domain Number 1 Region: 278-471
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-70
Family Hemopexin-like domain 0.00000000249
Further Details:      
 
Domain Number 2 Region: 106-269
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.67e-58
Family Matrix metalloproteases, catalytic domain 0.0000000295
Further Details:      
 
Domain Number 3 Region: 30-101
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-19
Family MMP N-terminal domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000260302   Gene: ENSG00000137745   Transcript: ENST00000260302
Sequence length 471
Comment pep:novel chromosome:GRCh38:11:102942995:102955734:-1 gene:ENSG00000137745 transcript:ENST00000260302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Download sequence
Identical sequences P45452
NP_002418.1.87134 NP_002418.1.92137 ENSP00000260302 ENSP00000461440 GO.57143 ENSP00000260302 9606.ENSP00000260302 gi|4505209|ref|NP_002418.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]