SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000261178 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261178
Domain Number 1 Region: 322-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.63e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00097
Further Details:      
 
Domain Number 2 Region: 57-127
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 
Domain Number 3 Region: 143-197,225-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000074
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261178   Gene: ENSG00000029153   Transcript: ENST00000261178
Sequence length 588
Comment pep:known chromosome:GRCh38:12:27333055:27420590:1 gene:ENSG00000029153 transcript:ENST00000261178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEEAAAGGKVLREENQCIAPVVSSRVSPGTRPTAMGSFSSHMTEFPRKRKGSDSDPS
QEAHSQTEKRRRDKMNNLIEELSAMIPQCNPMARKLDKLTVLRMAVQHLRSLKGLTNSYV
GSNYRPSFLQDNELRHLILKTAEGFLFVVGCERGKILFVSKSVSKILNYDQASLTGQSLF
DFLHPKDVAKVKEQLSSFDISPREKLIDAKTGLQVHSNLHAGRTRVYSGSRRSFFCRIKS
CKISVKEEHGCLPNSKKKEHRKFYTIHCTGYLRSWPPNIVGMEEERNSKKDNSNFTCLVA
IGRLQPYIVPQNSGEINVKPTEFITRFAVNGKFVYVDQRATAILGYLPQELLGTSCYEYF
HQDDHNNLTDKHKAVLQSKEKILTDSYKFRAKDGSFVTLKSQWFSFTNPWTKELEYIVSV
NTLVLGHSEPGEASFLPCSSQSSEESSRQSCMSVPGMSTGTVLGAGSIGTDIANEILDLQ
RLQSSSYLDDSSPTGLMKDTHTVNCRSMSNKELFPPSPSEMGELEATRQNQSTVAVHSHE
PLLSDGAQLDFDALCDNDDTAMAAFMNYLEAEGGLGDPGDFSDIQWTL
Download sequence
Identical sequences ENSP00000261178 NP_001234933.1.87134 NP_001234933.1.92137 ENSP00000261178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]