SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000261210 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261210
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 2.22e-23
Family LEM domain 0.0000504
Further Details:      
 
Domain Number 2 Region: 107-155
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000000017
Family LEM domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261210   Gene: ENSG00000120802   Transcript: ENST00000261210
Sequence length 248
Comment pep:novel chromosome:GRCh38:12:98515852:98537713:1 gene:ENSG00000120802 transcript:ENST00000261210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSK
GPPDFSSDEEREPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDL
LDQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDS
DRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRVEHNQVSLVLLPPCTGINNLLTTL
IHVLAFNG
Download sequence
Identical sequences ENSP00000261210 ENSP00000261210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]