SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000261733 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261733
Domain Number 1 Region: 37-515
Classification Level Classification E-value
Superfamily ALDH-like 0
Family ALDH-like 0.0000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261733   Gene: ENSG00000111275   Transcript: ENST00000261733
Sequence length 517
Comment pep:known chromosome:GRCh38:12:111766922:111809985:1 gene:ENSG00000111275 transcript:ENST00000261733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAARFGPRLGRRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCG
QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPG
FGPTAGAAIASHEDVDKVAFTGSTEIGRVIQVAAGSSNLKRVTLELGGKSPNIIMSDADM
DWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEFVERSVARAKSRVVGNPFDSKTEQGP
QVDETQFKKILGYINTGKQEGAKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGP
VMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQS
PFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences A0A2J8XKY0 P05091
gi|25777732|ref|NP_000681.2| NP_000681.2.87134 NP_000681.2.92137 9606.ENSP00000261733 ENSP00000261733 ENSP00000261733 5l13_A 5l13_B 5l13_C 5l13_D 5l13_E 5l13_F 5l13_G 5l13_H ENSP00000261733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]