SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264042 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264042
Domain Number 1 Region: 536-747
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-52
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 227-372
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-42
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 870-1024
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 731-856
Classification Level Classification E-value
Superfamily PH domain-like 2.83e-30
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 4.58e-28
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.16e-20
Family First domain of FERM 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264042   Gene: ENSG00000006607   Transcript: ENST00000264042
Sequence length 1054
Comment pep:known chromosome:GRCh38:2:241356243:241494841:1 gene:ENSG00000006607 transcript:ENST00000264042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDI
EPKCDGQVLLTQVWKRLNLVECDYFGMEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDETLD
REHLKVNEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYSGRTQKQLVDYFKDSGM
KRIPYERRHSKTHTSVRALTADLPKQSISFPEGLRTPASPSSANAFYSLSPSTLVPSGLP
EFKDSSSSLTDPQVSYVKSPAAERRSGAVAGGPDTPSAQPLGPPALQPGPGLSTKSPQPS
PSSRKSPLSLSPAFQVPLGPAEQGSSPLLSPVLSDAGGAGMDCEEPRHKRVPADEAYFIV
KEILATERTYLKDLEVITVWFRSAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQR
LALWEGPSKAHTKGSHQRIGDILLRNMRQLKEFTSYFQRHDEVLTELEKATKRCKKLEAV
YKEFELQKVCYLPLNTFLLKPIQRLLHYRLLLRRLCGHYSPGHHDYADCHDALKAITEVT
TTLQHILIRLENLQKLTELQRDLVGIENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSD
MLLYTSKGVAGTSHFRIRGLLPLQGMLVEESDNEWSVPHCFTIYAAQKTIVVAASTRLEK
EKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVRSSLEGH
GQHRANTTMHVCWYRNTSVSRADHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFF
YKTHQDDYPLASLPLLGYSVSIPREADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEV
IQGASSSAGRAPSIVQDGPQPSSGLEGMVRGKEE
Download sequence
Identical sequences O94887
ENSP00000264042 gi|7662310|ref|NP_055623.1| NP_055623.1.87134 NP_055623.1.92137 ENSP00000264042 9606.ENSP00000264042 ENSP00000264042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]