SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264051 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264051
Domain Number 1 Region: 254-474
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-54
Family DBL homology domain (DH-domain) 0.0000854
Further Details:      
 
Domain Number 2 Region: 465-602
Classification Level Classification E-value
Superfamily PH domain-like 1.68e-19
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 3 Region: 600-674
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264051   Gene: ENSG00000066248   Transcript: ENST00000264051
Sequence length 710
Comment pep:known chromosome:GRCh38:2:232878686:233013272:-1 gene:ENSG00000066248 transcript:ENST00000264051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRESEDLEKTRRKSASDQWNTDNEPAKVKPELLPEKEETSQADQDIQDKEPHCHIPIK
RNSIFNRSIRRKSKAKARDNPERNASCLADSQDNGKSVNEPLTLNIPWSRMPPCRTAMQT
DPGAQEMSESSSTPGNGATPEEWPALADSPTTLTEALRMIHPIPADSWRNLIEQIGLLYQ
EYRDKSTLQEIETRRQQDAEIEDNTNGSPASEDTPEEEEEEEEEEEPASPPERKTLPQIC
LLSNPHSRFNLWQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHFM
ENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHF
SVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLK
LLVQNILKRVEERSERECTALDAHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKS
VPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGDKYQVF
DSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMKRWMTSLAPNR
RTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNILDKTDDGWIFGERLHDQER
GWFPSSMTEEILNPKIRSQNLKECFRVHKMDDPQRSQNKDRRKLGSRNRQ
Download sequence
Identical sequences Q8N5V2
NP_062824.2.87134 NP_062824.2.92137 XP_011509225.1.92137 ENSP00000264051 ENSP00000264051 9606.ENSP00000264051 ENSP00000264051 gi|166197688|ref|NP_062824.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]