SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000264426 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000264426
Domain Number 1 Region: 414-528,648-794
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.82e-66
Family Phosphate binding protein-like 0.000000000547
Further Details:      
 
Domain Number 2 Region: 23-390
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-54
Family L-arabinose binding protein-like 0.009
Further Details:      
 
Domain Number 3 Region: 544-647
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000283
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000264426   Gene: ENSG00000120251   Transcript: ENST00000264426
Sequence length 883
Comment pep:known chromosome:GRCh38:4:157220764:157363945:1 gene:ENSG00000120251 transcript:ENST00000264426 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLAVLKLNEQGLL
DKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
Download sequence
Identical sequences A0A096MWL5 A0A2J8W0A8 A0A2K5CE25 A0A2K5IAE0 A0A2K5M0L9 A0A2K5ZBU4 A0A2K6M3W5 A0A2K6QZN1 A0A2K6SSE8 G1R3B7 H2QQC6 P42262
ENSNLEP00000007694 9598.ENSPTRP00000028409 9600.ENSPPYP00000016933 9606.ENSP00000264426 NP_001171924.2.37143 XP_003257941.1.23891 XP_003776589.1.23681 XP_003822600.1.60992 XP_003927988.1.74449 XP_004040607.1.27298 XP_007998288.1.81039 XP_010336866.1.74449 XP_010336867.1.74449 XP_010356347.1.97406 XP_011815108.1.43180 XP_011825890.1.47321 XP_011941947.1.92194 XP_012303907.1.9421 XP_017726529.1.44346 1198S ENSNLEP00000007689 ENSPTRP00000028409 ENSP00000389837 ENSP00000264426 ENSPTRP00000028409 ENSP00000264426 ENSPANP00000004273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]