SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265651 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265651
Domain Number 1 Region: 280-409
Classification Level Classification E-value
Superfamily ApaG-like 7.46e-41
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.14e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 4-81
Classification Level Classification E-value
Superfamily F-box domain 3.01e-18
Family F-box domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSP00000265651
Domain Number - Region: 419-451
Classification Level Classification E-value
Superfamily ARM repeat 0.00455
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265651   Gene: ENSG00000110429   Transcript: ENST00000265651
Sequence length 471
Comment pep:known chromosome:GRCh38:11:33740946:33774516:-1 gene:ENSG00000110429 transcript:ENST00000265651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKY
WLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVKNVVSGGFPIIRDQIFRYVHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSKDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRV
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKIFNVAIPRFHMACPTFRVSIARLEMGPDEY
EEMEEEEEEEEEEDEDDDSADMDESDEDDEEERRRRVFDVPIRRRRCSRLF
Download sequence
Identical sequences G1S8C1 G3S6Q5 H2NDR2 H2Q3E0 Q9UK99
ENSGGOP00000001919 ENSPPYP00000003870 NP_036307.2.87134 NP_036307.2.92137 XP_003254434.1.23891 XP_003830437.1.60992 XP_004050960.1.27298 XP_009244756.1.23681 XP_508358.2.37143 ENSGGOP00000023762 gi|15812186|ref|NP_036307.2| ENSPPYP00000003870 ENSPTRP00000006059 NYSGRC-15812186 ENSP00000265651 ENSNLEP00000021760 ENSNLEP00000021760 ENSP00000265651 9598.ENSPTRP00000006059 9600.ENSPPYP00000003870 9606.ENSP00000265651 ENSPTRP00000006059 ENSP00000265651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]