SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000265983 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000265983
Domain Number 1 Region: 48-235
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-62
Family Hemopexin-like domain 0.0000000119
Further Details:      
 
Domain Number 2 Region: 256-459
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-54
Family Hemopexin-like domain 0.00000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000265983   Gene: ENSG00000110169   Transcript: ENST00000265983
Sequence length 462
Comment pep:known chromosome:GRCh38:11:6431049:6441064:-1 gene:ENSG00000110169 transcript:ENST00000265983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLGAPVALGLWSLCWSLAIATPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATT
LDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYP
PEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKER
SWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRN
GTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQ
WPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSV
DAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSA
NGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH
Download sequence
Identical sequences P02790
ENSP00000265983 9606.ENSP00000265983 gi|11321561|ref|NP_000604.1| ENSP00000265983 NP_000604.1.87134 NP_000604.1.92137 ENSP00000265983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]