SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000267978 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000267978
Domain Number 1 Region: 620-1036
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-94
Family alpha-mannosidase, C-terminal domain 0.015
Further Details:      
 
Domain Number 2 Region: 248-515
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 8.9e-85
Family alpha-mannosidase 0.012
Further Details:      
 
Domain Number 3 Region: 516-617
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.85e-25
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000267978
Domain Number - Region: 71-119
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0276
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000267978   Gene: ENSG00000140400   Transcript: ENST00000267978
Sequence length 1040
Comment pep:known chromosome:GRCh38:15:75355207:75368630:-1 gene:ENSG00000140400 transcript:ENST00000267978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAV
QRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLT
KEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAV
FHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASR
FFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQA
QQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQE
FGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRV
LVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLS
NTDGLPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGNRECERIL
HDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAMCHYEDIR
SHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRIEVMALPKPGGAHSLALVTVPSMGYA
PVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASGREAIAEG
AVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISPN
SRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYN
TSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTG
RHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETV
KQAESSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDNRLK
LTFSPFQVLSLLLVLQPPPH
Download sequence
Identical sequences A0A140VJN9 Q9NTJ4
gi|46852164|ref|NP_006706.2| ENSP00000267978 ENSP00000267978 NYSGRC-46852164 9606.ENSP00000267978 NP_006706.2.87134 NP_006706.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]