SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000269878 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000269878
Domain Number 1 Region: 1-185
Classification Level Classification E-value
Superfamily EF-hand 1.38e-30
Family Calmodulin-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000269878   Gene: ENSG00000141977   Transcript: ENST00000269878
Sequence length 187
Comment pep:known chromosome:GRCh38:19:16161368:16173525:-1 gene:ENSG00000141977 transcript:ENST00000269878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKQTVFTHEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIG
SMPELKDNPFRQRIAQVFSEDGDGHMTLDNFLDMFSVMSEMAPRDLKAYYAFKIYDFNND
DYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDFQNMILRAPDFL
STFHIRI
Download sequence
Identical sequences Q96Q77
ENSP00000269878 9606.ENSP00000269878 ENSP00000269878 ENSP00000369188 NP_473454.1.87134 NP_473454.1.92137 gi|16930817|ref|NP_473454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]