SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000270188 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000270188
Domain Number 1 Region: 252-515
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.99e-87
Family Eukaryotic proteases 0.00000000047
Further Details:      
 
Domain Number 2 Region: 59-164
Classification Level Classification E-value
Superfamily Kringle-like 4.59e-32
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 167-255
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-31
Family Kringle modules 0.00000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000270188   Gene: ENSG00000104368   Transcript: ENST00000352041
Sequence length 516
Comment pep:known chromosome:GRCh38:8:42175237:42207676:-1 gene:ENSG00000104368 transcript:ENST00000352041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQGCSEPRCFNGGTCQQALYFSDF
VCQCPEGFAGKCCEIDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRP
DAIRLGLGNHNYCRNPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGT
HSLTESGASCLPWNSMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRL
TWEYCDVPSCSTCGLRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGIL
ISSCWILSAAHCFQERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDND
IALLQLKSDSSRCAQESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEA
HVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMT
LVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
Download sequence
Identical sequences gi|14702169|ref|NP_127509.1| NP_127509.1.87134 NP_127509.1.92137 ENSP00000270188 ENSP00000270188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]