SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000270747 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000270747
Domain Number 1 Region: 357-577
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-53
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 716-779
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000119
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 577-700
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000603
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000270747   Gene: ENSG00000142632   Transcript: ENST00000270747
Sequence length 802
Comment pep:known chromosome:GRCh38:1:16198104:16212609:-1 gene:ENSG00000142632 transcript:ENST00000270747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLQPHLTGPPGTAHHPVAVCQQESLSFAELPALKPPSPVCLDLFPVAPEELRA
PGSRWSLGTPAPLQGLLWPLSPGGSDTEITSGGMRPSRAGSWPHCPGAQPPALEGPWSPR
HTQPQRRASHGSEKKSAWRKMRVYQREEVPGCPEAHAVFLEPGQVVQEQALSTEEPRVEL
SGSTRVSLEGPERRRFSASELMTRLHSSLRLGRNSAARALISGSGTGAAREGKASGMEAR
SVEMSGDRVSRPAPGDSREGDWSEPRLDTQEEPPLGSRSTNERRQSRFLLNSVLYQEYSD
VASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPD
VRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECLGAQDKQWL
FSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTNQAYQERTY
QRLLLENPRFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKRTAQGSEDE
DMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARWLVRHGELV
ELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHAKMAELQVRDLSLKL
QGIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALCPSSPQEDKEVISEGEDCPQV
QCVRTYKALHPDELTLEKTDILSVRTWTSDGWLEGVRLADGEKGWVPQAYVEEISSLSAR
LRNLRENKRVTSATSKLGEAPV
Download sequence
Identical sequences Q8IW93
ENSP00000270747 NP_694945.2.87134 NP_694945.2.92137 XP_011539008.1.92137 9606.ENSP00000270747 ENSP00000270747 ENSP00000270747 gi|40255149|ref|NP_694945.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]