SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000272252 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000272252
Domain Number 1 Region: 14-340
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 2.45e-118
Family Aldose 1-epimerase (mutarotase) 0.00000000000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000272252   Gene: ENSG00000143891   Transcript: ENST00000272252
Sequence length 342
Comment pep:known chromosome:GRCh38:2:38665910:38734768:1 gene:ENSG00000143891 transcript:ENST00000272252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFA
ELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTP
RVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFN
LAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLN
GFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
HSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA
Download sequence
Identical sequences Q96C23
NP_620156.1.87134 NP_620156.1.92137 9606.ENSP00000272252 ENSP00000272252 000042246|e1snzB1|12.3.1.1|B:3-344 000042247|e1so0B1|12.3.1.1|B:3-344 000042249|e1so0D1|12.3.1.1|D:3-344 d1snza1 d1snzb_ d1so0a1 d1so0b_ d1so0c1 d1so0d_ ENSP00000272252 ENSP00000272252 gi|20270355|ref|NP_620156.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]