SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000273450 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000273450
Domain Number 1 Region: 425-911
Classification Level Classification E-value
Superfamily ALDH-like 1.7e-165
Family ALDH-like 0.000000000726
Further Details:      
 
Domain Number 2 Region: 11-211
Classification Level Classification E-value
Superfamily Formyltransferase 1.03e-50
Family Formyltransferase 0.00000000214
Further Details:      
 
Domain Number 3 Region: 215-316
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.04e-25
Family Post formyltransferase domain 0.000000881
Further Details:      
 
Domain Number 4 Region: 335-418
Classification Level Classification E-value
Superfamily ACP-like 0.0000059
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000273450   Gene: ENSG00000144908   Transcript: ENST00000273450
Sequence length 912
Comment pep:novel chromosome:GRCh38:3:126103569:126181186:-1 gene:ENSG00000144908 transcript:ENST00000273450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPSNPPATMKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDG
VPVFKYSRWRAKGQALPDVVAKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLL
PRHRGASAINWTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFP
EGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAKINWDQPAEAIHNWIRGNDKV
PGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVK
NIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKS
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVE
MAVNKRTVRMPHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKD
AFENGRWGKISARDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTF
RYFAGWCDKIQGSTIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAA
GNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTG
STEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVFFNKGENCIAA
GRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGA
TLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANAT
EFGLASGVFTRDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALN
EYLRVKTVTFEY
Download sequence
Identical sequences ENSP00000273450 ENSP00000273450 ENSP00000273450 NP_001257293.1.87134 NP_001257293.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]