SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000280571 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000280571
Domain Number 1 Region: 134-205
Classification Level Classification E-value
Superfamily RILP dimerisation region 3.27e-18
Family RILP dimerisation region 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000280571   Gene: ENSG00000150977   Transcript: ENST00000280571
Sequence length 211
Comment pep:known chromosome:GRCh38:12:123410683:123436717:-1 gene:ENSG00000150977 transcript:ENST00000280571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEPPVREEEEEEGEEDEERDEVGPEGALGKSPFQLTAEDVYDISYLLGRELMALGSDPR
VTQLQFKVVRVLEMLEALVNEGSLALEELKMERDHLRKEVEGLRRQSPPASGEVNLGPNK
MVVDLTDPNRPRFTLQELRDVLQERNKLKSQLLVVQEELQCYKSGLIPPREGPGGRREKD
AVVTSAKNAGRNKEEKTIIKKLFFFRSGKQT
Download sequence
Identical sequences Q969X0
ENSP00000280571 gi|21450828|ref|NP_659495.1| 9606.ENSP00000280571 ENSP00000280571 ENSP00000280571 NP_659495.1.92137 GO.40726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]