SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000284006 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000284006
Domain Number 1 Region: 57-158
Classification Level Classification E-value
Superfamily POZ domain 3.73e-29
Family Tetramerization domain of potassium channels 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000284006   Gene: ENSG00000153885   Transcript: ENST00000284006
Sequence length 234
Comment pep:known chromosome:GRCh38:19:33796862:33815763:1 gene:ENSG00000153885 transcript:ENST00000284006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHI
DVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTS
KLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGER
IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQDVL
Download sequence
Identical sequences A0A1D5R8Z3 A0A2I3SKM9 A0A2K5I7F3 A0A2K5KH88 A0A2K5ZVD5 H2NYC8
ENSMMUP00000014850 NP_076981.2.87134 NP_076981.2.92137 XP_003779180.1.23681 XP_011837703.1.47321 XP_015296410.1.63531 ENSPPYP00000011008 ENSP00000284006 gi|194018439|ref|NP_076981.2| 9544.ENSMMUP00000014850 9598.ENSPTRP00000018504 9600.ENSPPYP00000011008 ENSPPYP00000011008 ENSMMUP00000014850 ENSP00000284006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]