SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000285381 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000285381
Domain Number 1 Region: 3-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.4e-98
Family Carbonic anhydrase 0.000000000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000285381   Gene: ENSG00000164879   Transcript: ENST00000285381
Sequence length 260
Comment pep:known chromosome:GRCh38:8:85438827:85449040:1 gene:ENSG00000164879 transcript:ENST00000285381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Download sequence
Identical sequences P07451 V9HWA3
ENSP00000285381 gi|4885099|ref|NP_005172.1| ENSP00000285381 9606.ENSP00000285381 NP_005172.1.87134 NP_005172.1.92137 ENSP00000285381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]