SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000289361 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000289361
Domain Number 1 Region: 332-512
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.15e-67
Family SPRY domain 0.0000115
Further Details:      
 
Domain Number 2 Region: 31-143
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family V set domains (antibody variable domain-like) 0.0002
Further Details:      
 
Domain Number 3 Region: 159-234
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000128
Family C1 set domains (antibody constant domain-like) 0.023
Further Details:      
 
Weak hits

Sequence:  ENSP00000289361
Domain Number - Region: 258-303
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0518
Family YkuI C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000289361   Gene: ENSG00000026950   Transcript: ENST00000289361
Sequence length 513
Comment pep:known chromosome:GRCh38:6:26402237:26415216:1 gene:ENSG00000026950 transcript:ENST00000289361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMASFLAFLLLNFRVCLLLLQLLMPHSAQFSVLGPSGPILAMVGEDADLPCHLFPTMSA
ETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASD
SGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWS
NNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADP
FFRSAQRWIAALAGTLPVLLLLLGGAGYFLWQQQEEKKTQFRKKKREQELREMAWSTMKQ
EQSTRVKLLEELRWRSIQYASRGERHSAYNEWKKALFKPADVILDPKTANPILLVSEDQR
SVQRAKEPQDLPDNPERFNWHYCVLGCESFISGRHYWEVEVGDRKEWHIGVCSKNVQRKG
WVKMTPENGFWTMGLTDGNKYRTLTEPRTNLKLPKPPKKVGVFLDYETGDISFYNAVDGS
HIHTFLDVSFSEALYPVFRILTLEPTALTICPA
Download sequence
Identical sequences O00481
9606.ENSP00000289361 ENSP00000289361 ENSP00000289361 NYSGRC-IgSF-BT3A1_HUMAN ENSP00000289361 gi|37595558|ref|NP_008979.3| NP_008979.3.87134 NP_008979.3.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]