SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000289893 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000289893
Domain Number 1 Region: 174-352
Classification Level Classification E-value
Superfamily Plakin repeat 1.03e-49
Family Plakin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 1-170
Classification Level Classification E-value
Superfamily Plakin repeat 7.32e-44
Family Plakin repeat 0.0002
Further Details:      
 
Domain Number 3 Region: 802-998
Classification Level Classification E-value
Superfamily Plakin repeat 5.76e-43
Family Plakin repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 5151-5309
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 3836-3992
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-26
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 6 Region: 4762-4874
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-25
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 7 Region: 3725-3872
Classification Level Classification E-value
Superfamily Spectrin repeat 6.86e-25
Family Spectrin repeat 0.0062
Further Details:      
 
Domain Number 8 Region: 1094-1205
Classification Level Classification E-value
Superfamily Plakin repeat 8.5e-25
Family Plakin repeat 0.0013
Further Details:      
 
Domain Number 9 Region: 3290-3447
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-23
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 10 Region: 5305-5421
Classification Level Classification E-value
Superfamily Spectrin repeat 4.75e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 11 Region: 4954-5092
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 4651-4765
Classification Level Classification E-value
Superfamily Spectrin repeat 1.27e-21
Family Spectrin repeat 0.007
Further Details:      
 
Domain Number 13 Region: 5664-5746
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-21
Family GAS2 domain 0.00056
Further Details:      
 
Domain Number 14 Region: 5370-5497,5524-5555
Classification Level Classification E-value
Superfamily Spectrin repeat 1.36e-20
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 15 Region: 4286-4429
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 16 Region: 3945-4101
Classification Level Classification E-value
Superfamily Spectrin repeat 3.93e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 17 Region: 2402-2531
Classification Level Classification E-value
Superfamily Spectrin repeat 6.67e-18
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 18 Region: 4163-4320
Classification Level Classification E-value
Superfamily Spectrin repeat 4.9e-17
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 19 Region: 984-1089
Classification Level Classification E-value
Superfamily Plakin repeat 8.37e-17
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 20 Region: 4539-4656
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-16
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 21 Region: 4871-4986
Classification Level Classification E-value
Superfamily Spectrin repeat 6.19e-16
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 22 Region: 5575-5655
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000001
Family Polcalcin 0.057
Further Details:      
 
Domain Number 23 Region: 3504-3664
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000186
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 24 Region: 2957-3081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000024
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 25 Region: 3180-3301
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000925
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 26 Region: 2266-2389
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000288
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 27 Region: 2865-2969
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000196
Family Spectrin repeat 0.0073
Further Details:      
 
Domain Number 28 Region: 2731-2830
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000144
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 29 Region: 2512-2651
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000183
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 30 Region: 4433-4540
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000489
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 31 Region: 722-800
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000068
Family Plakin repeat 0.0019
Further Details:      
 
Domain Number 32 Region: 2046-2163
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000196
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 33 Region: 3089-3208
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000475
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 34 Region: 1878-2032
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000792
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000289893
Domain Number - Region: 2661-2755
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00102
Family Spectrin repeat 0.0092
Further Details:      
 
Domain Number - Region: 3639-3717
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0187
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000289893   Gene: ENSG00000127603   Transcript: ENST00000289893
Sequence length 5938
Comment pep:putative chromosome:GRCh38:1:39331138:39486987:1 gene:ENSG00000127603 transcript:ENST00000289893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGLLDQDTGLVLLESQVIMSGLIAPETGENLSLEEGIARNLINPQMYQQLRELQDALA
LISRLTESRGPLSVVEAIEKRIISETVGLKILEAHLATGGFSLSPSENCINLEEAFHQGL
ISAWLHSVLESYLRTSKNLIDPNTAEKIGLLDLMQRCIVHQESGFKLLPVKQLAGGMVSL
KSGRKVSIFRAVQEGLIDRQVTVRLLEAQLFAGGIVDPRTGHRLTVEEAVRHNLIDQDMA
CAILIRQLQTGGIIDTVTGQRLTIDEAVSNDLVAAKIALVILESLWSFMGLLWPESGEIL
PITDALEQGIVSTELAHKILSNRQHIKALFLPATTEILSWKKAIESGILDRDLANNLKSI
CIPDVMPHMQLADSAEQNINPGAAVLPCSKSHPKATASQSENLLFQLMTHSYINVQNGQR
LLLLDKELMETLTSRDEYQTSPPKVVEIGHQRQKTPEGLQESANVKISGTFSSGWTVRLP
EFQFSSQNKEYPDREDCTTEKGKKTTVETEDSSVENPEQDLFVEQKERNPNIDALKVINK
VKLEVQRQLIGTQREDQTAVSVRENASRGHLLTIPPAEAEGVPLVVDKDVFSVETPKKEH
QPLRNTSFTCQNEQAHTLETEYIHDETGGSHIKPQSKKLQVQVKKTLGIKLELKSETDGN
VHPLDKKEMLKKTFLAKDDHKESQEAQNIAGGSMMMSEKTDEEDSGREIFLSCSHPLELL
EEATLNVLSAQLLDGGIFHEQTGQKLLLNEAISRGIVPSHTAVKLMEKLNMFQGFFDSQT
CESLTTEEVINEGLMDEKLLHNVLMADKAISGVLDPRTQTLCSVKDAVTVGLLDKETATR
ILERQVVTGGIIDLKRGKKVSVTLASTLGLVDVADQPELINLEKASKGRDAEKTVRERLI
SLQMETTGLIDPDSKAPLTVVQSIDRGLLEREEAVRLLTKQVVDGGIIHHISGMRLSVDN
AFRHGLIGEDLAEKLKRVENLNIHQIFNPETKENISLPKAIKLDLITSDLKREIQEVQAF
TGNFVDLISGQRLTLAEAKKEGLLTNEAVLSPGMMHGIVDPENCRIVPYSELVKKCKIDI
ESGQRYLEVIPFSDIKDGVSDKVLTLSQAIQLGKVDFASTLKVLEAQANTGGIIDTATGK
RLTLASALEEKLVDENMVRIIASHQVLNGGIVDIFSDQRVTLVEAIEKRLISPELANMIQ
IDSSEFSDHRAQIEKQEGIEVCALQNEFLGKDMLIACNQTAEMSCNKVEESERLFQVENQ
SAQEKVKVRVSDGEQAKKSREISLKEFGCKDQRKPRMSSDAKEFISIINPHNLKGKSLGQ
VSLTHPYSECDFKLKEVARNNMGNDTNEEQEKAVTKIEIISHMKQSTSCLDSEEIRENQG
EVILEVQETYCETSGKLPSEQVLQQPMNARVKSKREKREVIVEESIRTCKPAFLSEEKLY
QETAIRDEHDSHIKSQPREMTSSEKGKEADTEMGFSITFKIEESSSQVVPQGISVKHLDA
LTLFSSKQANEGKVNNLSLCLTLKPEENLSREIACGAQSEPFPCMTPRPEGLHYQESDGK
AQVTGPSQISKTDKSFQGTTRQETNYQDSWVTSKTKETKHQISSSNECKEKSYQEVSFDP
ARGLKLEEITVSRPDSKEVRYLEFSDRKDLHHQGSKSDDKLCGTLKSEIATQELTGEKFL
EMANPNVAGLEAGSIEDIVTQRGSRVLGSFLPEKLFKGVSQKENTGQQNAIISPTVLETS
EEKTVSLTVCSAVKTEKTPQEKLRESPGSEQTPFMTAPEGKGNGGVNPEPFRATQNVFTR
QLCLEHDEKLVSYLSLLRNIEMRTKQIQPLELNLAELQDLLCQAKVLERELKDLTTLVSQ
ELECVNQIIISQPQEVPAQLLKALEKDAKNLQKSLSSVSDTWNSRLLHFQNAVEIEKTKV
LNQHTQLEGRLQDLRAWVGNKNLILNSKGSNSEIDVDSLNLCLQQYEDLKQPMAERKAQL
DALAFDIQFFISEHAQDLSPQQNRQMLRLLNELQRSFQDILEQTAAQVDALQGHLQQMEQ
EALVKTLQKQQNTCHQQLEDLCSWVGQAERALAGHQGRTTQQDLSALQKNQSDLKDLQDD
IQNRATSFATVVKDIEGFMEENQTKLSPRELTALREKLHQAKEQYEALQEETRVAQKELE
EAVTSALQQETEKSKAAKELAENKKKIDALLDWVTSVGSSGGQLLTNLPGMEQLSGASLE
KGALDTTDGYMGVNQAPEKLDKQCEMMKARHQELLSQQQNFILATQSAQAFLDQHGHNLT
PEEQQMLQQKLGELKEQYSTSLAQSEAELKQVQTLQDELQKFLQDHKEFESWLERSEKEL
ENMHKGGSSPETLPSLLKRQGSFSEDVISHKGDLRFVTISGQKVLDMENSFKEGKEPSEI
GNLVKDKLKDATERYTALHSKCTRLGSHLNMLLGQYHQFQNSADSLQAWMQACEANVEKL
LSDTVASDPGVLQEQLATTKQLQEELAEHQVPVEKLQKVARDIMEIEGEPAPDHRHVQET
TDSILSHFQSLSYSLAERSSLLQKAIAQSQSVQESLESLLQSIGEVEQNLEGKQVSSLSS
GVIQEALATNMKLKQDIARQKSSLEATREMVTRFMETADSTTAAVLQGKLAEVSQRFEQL
CLQQQEKESSLKKLLPQAEMFEHLSGKLQQFMENKSRMLASGNQPDQDITHFFQQIQELN
LEMEDQQENLDTLEHLVTELSSCGFALDLCQHQDRVQNLRKDFTELQKTVKEREKDASSC
QEQLDEFRKLVRTFQKWLKETEGSIPPTETSMSAKELEKQIEHLKSLLDDWASKGTLVEE
INCKGTSLENLIMEITAPDSQGKTGSILPSVGSSVGSVNGYHTCKDLTEIQCDMSDVNLK
YEKLGGVLHERQESLQAILNRMEEVHKEANSVLQWLESKEEVLKSMDAMSSPTKTETVKA
QAESNKAFLAELEQNSPKIQKVKEALAGLLVTYPNSQEAENWKKIQEELNSRWERATEVT
VARQRQLEESASHLACFQAAESQLRPWLMEKELMMGVLGPLSIDPNMLNAQKQQVQFMLK
EFEARRQQHEQLNEAAQGILTGPGDVSLSTSQVQKELQSINQKWVELTDKLNSRSSQIDQ
AIVKSTQYQELLQDLSEKVRAVGQRLSVQSAISTQPEAVKQQLEETSEIRSDLEQLDHEV
KEAQTLCDELSVLIGEQYLKDELKKRLETVALPLQGLEDLAADRINRLQAALASTQQFQQ
MFDELRTWLDDKQSQQAKNCPISAKLERLQSQLQENEEFQKSLNQHSGSYEVIVAEGESL
LLSVPPGEEKRTLQNQLVELKNHWEELSKKTADRQSRLKDCMQKAQKYQWHVEDLVPWIE
DCKAKMSELRVTLDPVQLESSLLRSKAMLNEVEKRRSLLEILNSAADILINSSEADEDGI
RDEKAGINQNMDAVTEELQAKTGSLEEMTQRLREFQESFKNIEKKVEGAKHQLEIFDALG
SQACSNKNLEKLRAQQEVLQALEPQVDYLRNFTQGLVEDAPDGSDASQLLHQAEVAQQEF
LEVKQRVNSGCVMMENKLEGIGQFHCRVREMFSQLADLDDELDGMGAIGRDTDSLQSQIE
DVRLFLNKIHVLKLDIEASEAECRHMLEEEGTLDLLGLKRELEALNKQCGKLTERGKARQ
EQLELTLGRVEDFYRKLKGLNDATTAAEEAEALQWVVGTEVEIINQQLADFKMFQKEQVD
PLQMKLQQVNGLGQGLIQSAGKDCDVQGLEHDMEEINARWNTLNKKVAQRIAQLQEALLH
CGKFQDALEPLLSWLADTEELIANQKPPSAEYKVVKAQIQEQKLLQRLLDDRKATVDMLQ
AEGGRIAQSAELADREKITGQLESLESRWTELLSKAAARQKQLEDILVLAKQFHETAEPI
SDFLSVTEKKLANSEPVGTQTAKIQQQIIRHKALEEDIENHATDVHQAVKIGQSLSSLTS
PAEQGVLSEKIDSLQARYSEIQDRCCRKAALLDQALSNARLFGEDEVEVLNWLAEVEDKL
SSVFVKDFKQDVLHRQHADHLALNEEIVNRKKNVDQAIKNGQALLKQTTGEEVLLIQEKL
DGIKTRYADITVTSSKALRTLEQARQLATKFQSTYEELTGWLREVEEELATSGGQSPTGE
QIPQFQQRQKELKKEVMEHRLVLDTVNEVSRALLELVPWRAREGLDKLVSDANEQYKLVS
DTIGQRVDEIDAAIQRSQQYEQAADAELAWVAETKRKLMALGPIRLEQDQTTAQLQVQKA
FSIDIIRHKDSMDELFSHRSEIFGTCGEEQKTVLQEKTESLIQQYEAISLLNSERYARLE
RAQVLVNQFWETYEELSPWIEETRALIAQLPSPAIDHEQLRQQQEEMRQLRESIAEHKPH
IDKLLKIGPQLKELNPEEGEMVEEKYQKAENMYAQIKEEVRQRALALDEAVSQSTQITEF
HDKIEPMLETLENLSSRLRMPPLIPAEVDKIRECISDNKSATVELEKLQPSFEALKRRGE
ELIGRSQGADKDLAAKEIQDKLDQMVFFWEDIKARAEEREIKFLDVLELAEKFWYDMAAL
LTTIKDTQDIVHDLESPGIDPSIIKQQVEAAETIKEETDGLHEELEFIRILGADLIFACG
ETEKPEVRKSIDEMNNAWENLNKTWKERLEKLEDAMQAAVQYQDTLQAMFDWLDNTVIKL
CTMPPVGTDLNTVKDQLNEMKEFKVEVYQQQIEMEKLNHQGELMLKKATDETDRDIIREP
LTELKHLWENLGEKIAHRQHKLEGALLALGQFQHALEELMSWLTHTEELLDAQRPISGDP
KVIEVELAKHHVLKNDVLAHQATVETVNKAGNELLESSAGDDASSLRSRLEAMNQCWESV
LQKTEEREQQLQSTLQQAQGFHSEIEDFLLELTRMESQLSASKPTGGLPETAREQLDTHM
ELYSQLKAKEETYNQLLDKGRLMLLSRDDSGSGSKTEQSVALLEQKWHVVSSKMEERKSK
LEEALNLATEFQNSLQEFINWLTLAEQSLNIASPPSLILNTVLSQIEEHKVFANEVNAHR
DQIIELDQTGNQLKFLSQKQDVVLIKNLLVSVQSRWEKVVQRSIERGRSLDDARKRAKQF
HEAWKKLIDWLEDAESHLDSELEISNDPDKIKLQLSKHKEFQKTLGGKQPVYDTTIRTGR
ALKEKTLLPEDSQKLDNFLGEVRDKWDTVCGKSVERQHKLEEALLFSGQFMDALQALVDW
LYKVEPQLAEDQPVHGDLDLVMNLMDAHKVFQKELGKRTGTVQVLKRSGRELIENSRDDT
TWVKGQLQELSTRWDTVCKLSVSKQSRLEQALKQAEVFRDTVHMLLEWLSEAEQTLRFRG
ALPDDTEALQSLIDTHKEFMKKVEEKRVDVNSAVAMGEVILAVCHPDCITTIKHWITIIR
ARFEEVLTWAKQHQQRLETALSELVANAELLEELLAWIQWAETTLIQRDQEPIPQNIDRV
KALIAEHQTFMEEMTRKQPDVDRVTKTYKRKNIEPTHAPFIEKSRSGGRKSLSQPTPPPM
PILSQSEAKNPRINQLSARWQQVWLLALERQRKLNDALDRLEELKEFANFDFDVWRKKYM
RWMNHKKSRVMDFFRRIDKDQDGKITRQEFIDGILASKFPTTKLEMTAVADIFDRDGDGY
IDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENKYRFFLGNQ
FGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNIELREKFILPEGASQ
GMTPFRSRGRRSKPSSRAASPTRSSSSASQSNHSCTSMPSSPATPASGTKVIPSSGSKLK
RPTPTFHSSRTSLAGDTSNSSSPASTGAKTNRADPKKSASRPGSRAGSRAGSRASSRRGS
DASDFDLLETQSACSDTSESSAAGGQGNSRRGLNKPSKIPTMSKKTTTASPRTPGPKR
Download sequence
Identical sequences 9606.ENSP00000289893 gi|33188443|ref|NP_149033.2| ENSP00000289893 ENSP00000289893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]