SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000292431 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000292431
Domain Number 1 Region: 3-120
Classification Level Classification E-value
Superfamily POZ domain 2.94e-29
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000292431   Gene: ENSG00000160877   Transcript: ENST00000292431
Sequence length 527
Comment pep:known chromosome:GRCh38:19:13118337:13141141:1 gene:ENSG00000160877 transcript:ENST00000292431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFN
NSRSAVVELPAAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFF
LKVSSPSCDSQGLHAEEAPSSEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMP
VAKRLWDSGQKEAGGGGNGSRKMAKFSTPDLAANRPHQPPPPQQAPVVAAAQPAVAAGAG
QPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQI
CNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQIGNRCHPKLY
DEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGI
RSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVK
VLKAEDDAYTTFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ
Download sequence
Identical sequences A0A024R7E0 G3SJX3 H2NXR2 H2QFI4 Q96RE7
ENSPPYP00000010787 ENSP00000292431 ENSP00000292431 ENSGGOP00000028415 9598.ENSPTRP00000018020 9600.ENSPPYP00000010787 9606.ENSP00000292431 NP_443108.1.87134 NP_443108.1.92137 XP_003814886.1.60992 XP_004060173.1.27298 XP_005259778.1.92137 XP_016790717.1.37143 XP_016790718.1.37143 gi|16418383|ref|NP_443108.1| ENSP00000292431 ENSPTRP00000018020 ENSGGOP00000028415 ENSPTRP00000018020 ENSPPYP00000010787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]