SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000292901 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000292901
Domain Number 1 Region: 2-109
Classification Level Classification E-value
Superfamily Globin-like 1.14e-38
Family Globins 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000292901   Gene: ENSG00000223609   Transcript: ENST00000292901
Sequence length 141
Comment pep:putative chromosome:GRCh38:11:5232678:5234483:-1 gene:ENSG00000223609 transcript:ENST00000292901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRVCKKVPEALQIGSTC
LFYKEYMGKEKSKGTVQGING
Download sequence
Identical sequences E9PFT6
ENSP00000292901 ENSP00000292901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]