SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296277 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296277
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 2.35e-20
Family Ribosomal protein L39e 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296277   Gene: ENSG00000163923   Transcript: ENST00000296277
Sequence length 51
Comment pep:known chromosome:GRCh38:3:187120948:187139523:-1 gene:ENSG00000163923 transcript:ENST00000296277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences Q96EH5
NP_443201.1.87134 NP_443201.1.92137 9606.ENSP00000296277 ENSP00000296277 ENSP00000389356 ENSP00000397240 ENSP00000296277 ENSP00000296277 ENSP00000389356 ENSP00000397240 gi|16579830|ref|NP_443201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]