SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000296498 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296498
Domain Number 1 Region: 614-874
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-80
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 280-382
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 498-599
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 387-487
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 167-270
Classification Level Classification E-value
Superfamily SRCR-like 3.4e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 99-171
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-16
Family Kringle modules 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296498   Gene: ENSG00000164099   Transcript: ENST00000296498
Sequence length 875
Comment pep:known chromosome:GRCh38:4:118280038:118353003:-1 gene:ENSG00000164099 transcript:ENST00000296498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVLALMLGALPEVVGFDSVLNDSLHHSHRHSPPAGPHYPYYLPTQQRPPRTRPPP
PLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGAPCLRWAEVPPFLE
RSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEFE
GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCR
GDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLAGGSSVHEGRVELYHAGQ
WGTVCDDQWDDADAEVICRQLGLSGIAKAWHQAYFGEGSGPVMLDEVRCTGNELSIEQCP
KSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTELN
TYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRED
VSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICRQ
LGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVICD
YFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSSHGDGRLL
CGATLLSSCWVLTAAHCFKRYGNSTRSYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYRP
DRSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSRT
LQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWVV
YGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences P56730
ENSP00000296498 NP_003610.2.87134 NP_003610.2.92137 ENSP00000296498 ENSP00000296498 gi|300244530|ref|NP_003610.2| 9606.ENSP00000296498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]