SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000298173 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000298173
Domain Number 1 Region: 7-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000994
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000298173   Gene: ENSG00000165417   Transcript: ENST00000298173
Sequence length 59
Comment pep:known chromosome:GRCh38:14:81180178:81220952:-1 gene:ENSG00000165417 transcript:ENST00000298173 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTILNKTVAAQKMFILW
Download sequence
Identical sequences A0A2J8PKI8 A0A2J8W5K2 J3KNC0
ENSP00000298173 ENSP00000298173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]