SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000299855 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299855
Domain Number 1 Region: 284-477
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.07e-69
Family Hemopexin-like domain 0.000000505
Further Details:      
 
Domain Number 2 Region: 101-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.07e-58
Family Matrix metalloproteases, catalytic domain 0.0000000302
Further Details:      
 
Domain Number 3 Region: 33-97
Classification Level Classification E-value
Superfamily PGBD-like 1.88e-20
Family MMP N-terminal domain 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299855   Gene: ENSG00000149968   Transcript: ENST00000299855
Sequence length 477
Comment pep:known chromosome:GRCh38:11:102835801:102843803:-1 gene:ENSG00000149968 transcript:ENST00000299855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Download sequence
Identical sequences P08254
9606.ENSP00000299855 ENSP00000299855 ENSP00000458496 NP_002413.1.87134 NP_002413.1.92137 gi|4505217|ref|NP_002413.1| ENSP00000299855 ENSP00000458496 ENSP00000299855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]