SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000300862 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300862
Domain Number 1 Region: 239-340
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.49e-23
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0000571
Further Details:      
 
Domain Number 2 Region: 91-153
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000288
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.053
Further Details:      
 
Domain Number 3 Region: 12-68
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000300862   Gene: ENSG00000124440   Transcript: ENST00000300862
Sequence length 667
Comment pep:known chromosome:GRCh38:19:46303599:46340100:1 gene:ENSG00000124440 transcript:ENST00000300862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDWQDHRSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAHLDKASIMRLTIS
YLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVLTAEGDMAYLSENVSKHLGLSQL
ELIGHSIFDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLK
AATWKVLNCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFL
SRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTG
QYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVVLSLEQTEQHSRR
PIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPIL
DGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDA
DALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPR
WGSDPRLSCSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHEN
FLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDEDTTQPGGPFQPR
AGSAQAD
Download sequence
Identical sequences ENSP00000300862 gi|23065535|ref|NP_690007.1| NP_690007.1.87134 NP_690007.1.92137 ENSP00000300862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]