SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000300900 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000300900
Domain Number 1 Region: 23-283
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.96e-84
Family Carbonic anhydrase 0.0000000000949
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000300900   Gene: ENSG00000167434   Transcript: ENST00000300900
Sequence length 312
Comment pep:known chromosome:GRCh38:17:60149936:60159540:1 gene:ENSG00000167434 transcript:ENST00000300900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTK
AKVDKKLGRFFFSGYDKKQTWTVQNNGHSVMMLLENKASISGGGLPAPYQAKQLHLHWSD
LPYKGSEHSLDGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF
QPLVEALSNIPKPEMSTTMAESSLLDLLPKEEKLRHYFRYLGSLTTPTCDEKVVWTVFRE
PIQLHREQILAFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
PMLACLLAGFLR
Download sequence
Identical sequences P22748
NP_000708.1.87134 NP_000708.1.92137 ENSP00000300900 gi|4502519|ref|NP_000708.1| 9606.ENSP00000300900 ENSP00000300900 ENSP00000300900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]