SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301032 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301032
Domain Number 1 Region: 78-206
Classification Level Classification E-value
Superfamily E set domains 8.4e-42
Family RhoGDI-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301032   Gene: ENSG00000109103   Transcript: ENST00000301032
Sequence length 220
Comment pep:known chromosome:GRCh38:17:28546708:28552631:-1 gene:ENSG00000109103 transcript:ENST00000301032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPI
GPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRD
LDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFG
FCIPSSKNTCEHIYDFPPLSEELSARAGSSGSGEVGASRD
Download sequence
Identical sequences ENSP00000301032 NP_473376.1.87134 NP_473376.1.92137 gi|16936535|ref|NP_473376.1| ENSP00000301032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]