SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301328 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301328
Domain Number 1 Region: 156-276
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000000000725
Family Glyoxalase I (lactoylglutathione lyase) 0.024
Further Details:      
 
Domain Number 2 Region: 4-145
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000234
Family Glyoxalase I (lactoylglutathione lyase) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301328   Gene: ENSG00000167699   Transcript: ENST00000301328
Sequence length 313
Comment pep:known chromosome:GRCh38:17:759330:782279:-1 gene:ENSG00000167699 transcript:ENST00000301328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKVESCSVARLECSGAISAHCSDYTRITEDSF
SKPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEW
PLTEVAEGVFETEAPGGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYE
KDEEKQRALLGYADNQCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKI
LTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSD
EWFAKHNKPKASG
Download sequence
Identical sequences Q9HC38
ENSP00000301329 ENSP00000301328 ENSP00000301328

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]