SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000301329 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000301329
Domain Number 1 Region: 141-261
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00000000000000658
Family Glyoxalase I (lactoylglutathione lyase) 0.024
Further Details:      
 
Domain Number 2 Region: 4-130
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000022
Family Glyoxalase I (lactoylglutathione lyase) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301329   Gene: ENSG00000167699   Transcript: ENST00000301329
Sequence length 298
Comment pep:known chromosome:GRCh38:17:759097:782341:-1 gene:ENSG00000167699 transcript:ENST00000301329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARRALHFVFKVGNRFQTARFYRDVLGMKVLRHEEFEEGCKAACNGPYDGKWSKTMVGF
GPEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVAEGVFETEAP
GGYKFYLQNRSLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADN
QCKLELQGVKGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATV
QVVILADPDGHEICFVGDEAFRELSKMDPEGSKLLDDAMAADKSDEWFAKHNKPKASG
Download sequence
Identical sequences ENSP00000301329 399863 HR6598 gi|217330598|ref|NP_057164.3| 9606.ENSP00000301329 ENSP00000301329 NP_057164.3.87134 NP_057164.3.92137 XP_004058260.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]