SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000301908 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000301908
Domain Number - Region: 11-55
Classification Level Classification E-value
Superfamily Tim10-like 0.0301
Family Tim10/DDP 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000301908   Gene: ENSG00000168081   Transcript: ENST00000301908
Sequence length 176
Comment pep:known chromosome:GRCh38:8:28317132:28343355:1 gene:ENSG00000168081 transcript:ENST00000301908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTP
CTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGE
MEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV
Download sequence
Identical sequences G3RI49 H2QVY8 Q13519
ENSP00000301908 gi|5453922|ref|NP_006219.1| NP_006219.1.87134 NP_006219.1.92137 XP_004046886.2.27298 XP_519684.3.37143 9598.ENSPTRP00000034436 9606.ENSP00000301908 ENSP00000301908 ENSP00000301908 ENSPTRP00000034436 ENSPTRP00000034436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]