SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000302552 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000302552
Domain Number 1 Region: 32-157
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 7.75e-23
Family Extradiol dioxygenases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000302552   Gene: ENSG00000171433   Transcript: ENST00000303227
Sequence length 160
Comment pep:known chromosome:GRCh38:X:48761750:48773646:1 gene:ENSG00000171433 transcript:ENST00000303227 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRHLPSRLPVKMWGRTLEKQSWRDSSQTPPPCLIRRLDHIVMTVKSIKDTTMFYSKILG
MEVMTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKA
CDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS
Download sequence
Identical sequences A6NK44 G3QWL3
ENSP00000409523 gi|254039722|ref|NP_001073958.2| ENSP00000302552 ENSP00000472014 NP_001073958.2.87134 NP_001073958.2.92137 XP_004064153.1.27298 ENSP00000302552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]