SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000303132 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000303132
Domain Number 1 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.04e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 
Domain Number 2 Region: 136-249
Classification Level Classification E-value
Superfamily DNA-glycosylase 8.03e-29
Family DNA repair glycosylase, 2 C-terminal domains 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000303132   Gene: ENSG00000114026   Transcript: ENST00000349503
Sequence length 357
Comment pep:known chromosome:GRCh38:3:9749944:9766668:1 gene:ENSG00000114026 transcript:ENST00000349503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKGLLGNAFDGHQLLRPLIFCQDHLREGPPIGRGDSQGEELEPQLPSSLSSIP
YGFCDHCWTKDVDDPPLVTHPSPGSRDGHMTQAWPVKVVSPLATVIGHVMQASLLAL
Download sequence
Identical sequences E5KPM6
NP_058434.1.87134 NP_058434.1.92137 ENSP00000303132 ENSP00000303132 gi|8670536|ref|NP_058434.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]