SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000306178 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000306178
Domain Number - Region: 196-228
Classification Level Classification E-value
Superfamily Kringle-like 0.0593
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000306178   Gene: ENSG00000169507   Transcript: ENST00000303735
Sequence length 384
Comment pep:known chromosome:GRCh38:2:164896186:164955525:-1 gene:ENSG00000169507 transcript:ENST00000303735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAKLGKVSLISTGLTTLILGIVMAR
AISLGPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHNSFLVYSSLEEPTVAKWSRLIHM
SIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDLVTFGRFCYGVTVILTYPMECFV
TREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLLIDCLGIVLELNGVLCATPLIFIIP
SACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMAITNTQDCTHGQEMFYCFPDNFS
LTNTSESHVQQTTQLSTLNISIFQ
Download sequence
Identical sequences 9606.ENSP00000306178 ENSP00000306178 NP_775783.1.87134 NP_775783.1.92137 ENSP00000306178 gi|27735137|ref|NP_775783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]