SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000306561 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000306561
Domain Number 1 Region: 136-318
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.83e-47
Family DNA repair glycosylase, 2 C-terminal domains 0.0000000182
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.46e-38
Family DNA repair glycosylase, N-terminal domain 0.000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000306561   Gene: ENSG00000114026   Transcript: ENST00000302036
Sequence length 424
Comment pep:known chromosome:GRCh38:3:9749944:9766737:1 gene:ENSG00000114026 transcript:ENST00000302036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARALLPRRMGHRTLASTPALWASIPCPRSELRLDLVLPSGQSFRWREQSPAHWSGVLA
DQVWTLTQTEEQLHCTVYRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHF
QEVAQKFQGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVTYHG
FPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQLRESSYEEAHKAL
CILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQRDYSWHPTTSQAKGPSPQTNKELG
NFFRSLWGPYAGWAQAGLLGNAFDGHQLLRPLIFCQDHLREGPPIGRGDSQGEELEPQLP
SSLSSIPYGFCDHCWTKDVDDPPLVTHPSPGSRDGHMTQAWPVKVVSPLATVIGHVMQAS
LLAL
Download sequence
Identical sequences E5KPM5
ENSP00000306561 gi|8670534|ref|NP_058214.1| 9606.ENSP00000306561 ENSP00000306561 NP_058214.1.87134 NP_058214.1.92137 ENSP00000303132 HR6786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]