SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000307900 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000307900
Domain Number 1 Region: 110-362
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.47e-79
Family Glutamine synthetase catalytic domain 0.0017
Further Details:      
 
Domain Number 2 Region: 20-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 3.53e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000307900   Gene: ENSG00000135821   Transcript: ENST00000311223
Sequence length 373
Comment pep:known chromosome:GRCh38:1:182381705:182392206:-1 gene:ENSG00000135821 transcript:ENST00000311223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEW
NFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRI
MDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCL
LNETGDEPFQYKN
Download sequence
Identical sequences A0A0D9RJ85 A0A2J8V806 A0A2K5TNL4 A0A2K5Y530 A0A2K6B8J1 A8YXX4 F7CAM5 G1S8N9 G3SJV7 H2Q0Q5 P15104
ENSGGOP00000028398 ENSNLEP00000021878 gi|19923206|ref|NP_002056.2| gi|74271826|ref|NP_001028228.1| gi|74271837|ref|NP_001028216.1| ENSMMUP00000030136 ENSP00000307900 ENSMMUP00000030136 ENSMMUP00000037864 ENSPTRP00000002925 9544.ENSMMUP00000030136 9598.ENSPTRP00000002925 9600.ENSPPYP00000000500 9606.ENSP00000307900 ENSNLEP00000021878 ENSPTRP00000002925 Hs19923206___KOG0683 ENSPANP00000018229 ENSP00000307900 ENSP00000344958 ENSP00000356537 ENSP00000398320 ENSP00000307900 ENSP00000344958 ENSP00000356537 ENSP00000398320 NP_001028216.1.87134 NP_001028216.1.92137 NP_001028228.1.87134 NP_001028228.1.92137 NP_001252942.1.72884 NP_002056.2.87134 NP_002056.2.92137 XP_002809762.1.23681 XP_003264477.1.23891 XP_003824783.1.60992 XP_004028058.1.27298 XP_004028059.1.27298 XP_005540219.1.63531 XP_006711341.1.92137 XP_007987475.1.81039 XP_007987476.1.81039 XP_008976634.1.60992 XP_008976635.1.60992 XP_009435822.1.37143 XP_009435829.1.37143 XP_009435833.1.37143 XP_011744567.1.29376 XP_011744568.1.29376 XP_011828284.1.47321 XP_018883103.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]