SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000308208 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000308208
Domain Number 1 Region: 313-508
Classification Level Classification E-value
Superfamily Hemopexin-like domain 9.68e-70
Family Hemopexin-like domain 0.0000117
Further Details:      
 
Domain Number 2 Region: 115-284
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.52e-55
Family Matrix metalloproteases, catalytic domain 0.0000000218
Further Details:      
 
Domain Number 3 Region: 25-98
Classification Level Classification E-value
Superfamily PGBD-like 2.51e-20
Family MMP N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000308208   Gene: ENSG00000157227   Transcript: ENST00000311852
Sequence length 582
Comment pep:known chromosome:GRCh38:14:22836557:22847761:1 gene:ENSG00000157227 transcript:ENST00000311852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Download sequence
Identical sequences P50281
ENSP00000308208 gi|4826834|ref|NP_004986.1| ENSP00000308208 ENSP00000308208 9606.ENSP00000308208 NP_004986.1.87134 NP_004986.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]