SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000309831 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000309831
Domain Number 1 Region: 91-277
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.18e-24
Family Adenylation domain of NAD+-dependent DNA ligase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000309831   Gene: ENSG00000169371   Transcript: ENST00000308588
Sequence length 360
Comment pep:known chromosome:GRCh38:15:75598083:75625815:-1 gene:ENSG00000169371 transcript:ENST00000308588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD
YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN
Download sequence
Identical sequences O95149
NP_001036046.1.87134 NP_001036046.1.92137 NP_001036053.1.87134 NP_001036053.1.92137 NP_005692.1.87134 NP_005692.1.92137 GO.36572 9606.ENSP00000309831 gi|110611149|ref|NP_001036046.1| gi|110611151|ref|NP_001036053.1| gi|5031833|ref|NP_005692.1| ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053 ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]