SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310951 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000310951
Domain Number - Region: 142-189
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.00785
Family Heat shock protein 15 kD 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310951   Gene: ENSG00000130349   Transcript: ENST00000311381
Sequence length 240
Comment pep:known chromosome:GRCh38:6:107028213:107051342:1 gene:ENSG00000130349 transcript:ENST00000311381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFY
NIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEE
ELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSR
TVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK
Download sequence
Identical sequences Q9P0P8
NP_001135940.1.87134 NP_001135940.1.92137 NP_057571.1.87134 NP_057571.1.92137 9606.ENSP00000310951 gi|215599508|ref|NP_001135940.1| gi|7706029|ref|NP_057571.1| GO.35357 ENSP00000310951 ENSP00000384867 ENSP00000310951 ENSP00000384867 ENSP00000475514 ENSP00000476138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]