SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311360 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311360
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 3.42e-18
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311360   Gene: ENSG00000172613   Transcript: ENST00000307980
Sequence length 391
Comment pep:known chromosome:GRCh38:11:67391952:67398409:1 gene:ENSG00000172613 transcript:ENST00000307980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKK
FRSLFFGSILAPVRSPQGPSPVLAEDSEGEG
Download sequence
Identical sequences K7DL38 Q99638
ENSP00000311360 ENSP00000311360 HR3319 9606.ENSP00000311360 ENSP00000311360 NP_004575.1.87134 NP_004575.1.92137 XP_016776852.1.37143 gi|4759022|ref|NP_004575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]