SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311463 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311463
Domain Number 1 Region: 101-502
Classification Level Classification E-value
Superfamily MFS general substrate transporter 2.62e-51
Family Glycerol-3-phosphate transporter 0.023
Further Details:      
 
Weak hits

Sequence:  ENSP00000311463
Domain Number - Region: 40-73
Classification Level Classification E-value
Superfamily Kringle-like 0.0534
Family Kringle modules 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311463   Gene: ENSG00000149452   Transcript: ENST00000311438
Sequence length 533
Comment pep:novel chromosome:GRCh38:11:62993237:63014958:-1 gene:ENSG00000149452 transcript:ENST00000311438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPW
VLPMGPNGKPERCLRFVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNK
LKEMAQSIFMAGILIGGLVLGDLSDRFGRRPILTCSYLLLAASGSGAAFSPTFPIYMVFR
FLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFILPGLAYAIPQWRWLQL
TVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQI
IFGGVDVPAKFITILSLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKG
CLSSSFSCLFLYTSELYPTVIRQTGMGVSNLWTRVGSMVSPLVKITGEVQPFIPNIIYGI
TALLGGSAALFLPETLNQPLPETIEDLENWSVTASGPISAPPWGSRSGPRAFP
Download sequence
Identical sequences H7BXN9
ENSP00000311463 ENSP00000311463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]