SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000311646 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000311646
Domain Number 1 Region: 16-387
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.42e-69
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Domain Number 2 Region: 407-521,640-780
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.91e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Weak hits

Sequence:  ENSP00000311646
Domain Number - Region: 490-635
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000471
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000311646   Gene: ENSG00000171189   Transcript: ENST00000309434
Sequence length 879
Comment pep:known chromosome:GRCh38:21:29553558:29694064:-1 gene:ENSG00000171189 transcript:ENST00000309434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGIFETVENEPVNVEELAFKFAVTSINRNRTLMPNTTLTYDIQRINLFDSFEASRRACDQ
LALGVAALFGPSHSSSVSAVQSICNALEVPHIQTRWKHPSVDNKDLFYINLYPDYAAISR
AILDLVLYYNWKTVTVVYEDSTGLIRLQELIKAPSRYNIKIKIRQLPSGNKDAKPLLKEM
KKGKEFYVIFDCSHETAAEILKQILFMGMMTEYYHYFFTTLDLFALDLELYRYSGVNMTG
FRLLNIDNPHVSSIIEKWSMERLQAPPRPETGLLDGMMTTEAALMYDAVYMVAIASHRAS
QLTVSSLQCHRHKPWRLGPRFMNLIKEARWDGLTGHITFNKTNGLRKDFDLDIISLKEEG
TEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTDSNKDKSSNITDSLANRTLIVTTILEEPY
VMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGAQNDKGEWNGMVKE
LIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIW
MYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGS
ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGA
VRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEY
VTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGC
PEEDNKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFCFFYGLQC
KQTHPTNSTSGTTLSTDLECGKLIREERGIRKQSSVHTV
Download sequence
Identical sequences A0A1D5RE40
ENSP00000311646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]