SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000312224 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000312224
Domain Number 1 Region: 9-168
Classification Level Classification E-value
Superfamily DTD-like 2.09e-43
Family DTD-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000312224   Gene: ENSG00000129480   Transcript: ENST00000310850
Sequence length 168
Comment pep:known chromosome:GRCh38:14:31446036:31457510:-1 gene:ENSG00000129480 transcript:ENST00000310850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKM
VNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYS
QFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF
Download sequence
Identical sequences Q96FN9
ENSP00000312224 ENSP00000312224 ENSP00000348503 ENSP00000312224 ENSP00000348503 9606.ENSP00000312224 gi|18087837|ref|NP_542395.1| NP_542395.1.87134 NP_542395.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]